Ver mas grande
VEGFA (Equine) Recombinant Protein
AB-P9320
Producto nuevo
VEGFA (Equine) Recombinant Protein
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | LOC100033839 |
| Gene Alias | - |
| Gene Description | vascular endothelial growth factor 164 |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | MAPMAEGEHKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTAEFNITMQIMRIKPHQSQHIGEMSFLQHSKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from a solution containing 10 mM Sodium Phosphate, pH 7.5. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 0.1 mg/mL. |
| Gene ID | 100033839 |
Más información
Equine Vegfa recombinant protein expressed in?Escherichia coli.