Ver mas grande
Vegfa (Rat) Recombinant Protein
AB-P9319
Producto nuevo
Vegfa (Rat) Recombinant Protein
Comprando este producto generará 12 Biopuntos. Su cesta contiene un total 12 Biopuntos puede ser convertido en un Biobonos Descuento 48.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | Vegfa |
| Gene Alias | VEGF164|Vegf |
| Gene Description | vascular endothelial growth factor A |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC for long term storage. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR |
| Form | Lyophilized |
| Antigen species Target species | Rat |
| Storage Buffer | Lyophilized from 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 83785 |
Más información
Rat Vegfa recombinant protein in?Saccharomyces cerevisiae.