TWSG1 (Human) Recombinant Protein Ver mas grande

Human TWSG1 partial recombinant protein expressed in CHO cells.

AB-P9280

Producto nuevo

TWSG1 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 ug
Gene Name TWSG1
Gene Alias TSG
Gene Description twisted gastrulation homolog 1 (Drosophila)
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe
Immunogen Prot. Seq CNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 1X PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 57045

Más información

Human TWSG1 partial recombinant protein expressed in CHO cells.

Consulta sobre un producto

Human TWSG1 partial recombinant protein expressed in CHO cells.

Human TWSG1 partial recombinant protein expressed in CHO cells.