Ver mas grande
Rat Tnf recombinant protein expressed in iEscherichia coli/i.
AB-P9227
Producto nuevo
Tnf (Rat) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Tnf |
| Gene Alias | MGC124630|RATTNF|TNF-alpha|Tnfa |
| Gene Description | tumor necrosis factor (TNF superfamily, member 2) |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | MLRSSSQNSSDKPVVHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFATSYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVSQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL |
| Form | Lyophilized |
| Antigen species Target species | Rat |
| Storage Buffer | Protein (1 mg/mL) was lyophilized from a solution containing 20 mM phosphate buffer, 0.1 M NaCl. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 24835 |
Más información
Rat Tnf recombinant protein expressed in Escherichia coli.