Ver mas grande
Human TGFB1 partial recombinant protein expressed in iEscherichia coli/i.
AB-P9205
Producto nuevo
TGFB1 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | TGFB3 |
| Gene Alias | ARVD|FLJ16571|TGF-beta3 |
| Gene Description | transforming growth factor, beta 3 |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Specificity | TGFB1 (113 a.a.) Human |
| Immunogen Prot. Seq | MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution containing 10 mM Sodium Citrate, pH3.5, 10% glycerol. |
| Gene ID | 7043 |
Más información
Human TGFB1 partial recombinant protein expressed in Escherichia coli.