Ver mas grande
SAA1 (Monkey) Recombinant Protein
AB-P9176
Producto nuevo
SAA1 (Monkey) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | LOC694944 |
| Gene Alias | - |
| Gene Description | similar to serum amyloid A1 isoform 2 |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | RSWFSFLGEAYDGARDMWRAYSDMKEANYKNSDKYFHARGNYDAAQRGPGGVWAAEVISDARENIQKLLGRGAEDTLADQAANEWGRSGKDPNHFRPAGLPEKY |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 694944 |
Más información
Monkey SAA1 recombinant protein with expressed in Escherichia coli.