TNFRSF11A (Human) Recombinant Protein Ver mas grande

Human TNFRSF11A partial recombinant protein with hIgG-His tag in C-terminus expressed in Baculovirus cells.

AB-P9140

Producto nuevo

TNFRSF11A (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name TNFRSF11A
Gene Alias CD265|FEO|LOH18CR1|ODFR|OFE|OPTB7|OSTS|PDB2|RANK|TRANCER
Gene Description tumor necrosis factor receptor superfamily, member 11a, NFKB activator
Storage Conditions Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq ADPLQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLPLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (1 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Gene ID 8792
Iso type Sf9, Baculovirus cells.

Más información

Human TNFRSF11A partial recombinant protein with hIgG-His tag in C-terminus expressed in Baculovirus cells.

Consulta sobre un producto

Human TNFRSF11A partial recombinant protein with hIgG-His tag in C-terminus expressed in Baculovirus cells.

Human TNFRSF11A partial recombinant protein with hIgG-His tag in C-terminus expressed in Baculovirus cells.