AB-P9136
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Size | 25 ug |
Gene Name | DHH |
Gene Alias | HHG-3|MGC35145 |
Gene Description | desert hedgehog homolog (Drosophila) |
Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG |
Form | Liquid |
Antigen species Target species | Human |
Storage Buffer | Solution containing 20 mM MES ,pH 5.5, 20% glycerol, 0.5 mM DTT. |
Gene ID | 50846 |
Iso type | Escherichia Coli. |