Ver mas grande
Mouse Shh partial recombinant protein with His tag in C-terminus expressed in iEscherichia coli/i.
AB-P9134
Producto nuevo
Shh (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | Shh |
| Gene Alias | 9530036O11Rik|Dsh|Hhg1|Hx|Hxl3|M100081 |
| Gene Description | sonic hedgehog |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MCGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGLEHHHHHH |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | Solution containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 1 mM DTT. |
| Gene ID | 20423 |
| Iso type | Escherichia Coli. |
Más información
Mouse Shh partial recombinant protein with His tag in C-terminus expressed in Escherichia coli.