Ver mas grande
CD79A (Human) Recombinant Protein
AB-P9104
Producto nuevo
CD79A (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | CD79A |
| Gene Alias | IGA|MB-1 |
| Gene Description | CD79a molecule, immunoglobulin-associated alpha |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRLEHHHHHH. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | PBS (pH7.4) and 10% glycerol. |
| Gene ID | 973 |
Más información
Human CD79A (P11912, 33 a.a. - 143 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.