Ver mas grande
CD40 (Human) Recombinant Protein
AB-P9085
Producto nuevo
CD40 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | CD40 |
| Gene Alias | Bp50|CDW40|MGC9013|TNFRSF5|p50 |
| Gene Description | CD40 molecule, TNF receptor superfamily member 5 |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 10% glycerol and Phosphate-Buffered Saline (pH 7.4). |
| Gene ID | 958 |
Más información
Human CD40 (P25942, 21 a.a. - 193 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in HEK293 cell.