Ver mas grande
CD3E (Human) Recombinant Protein
AB-P9083
Producto nuevo
CD3E (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | CD3E |
| Gene Alias | FLJ18683|T3E|TCRE |
| Gene Description | CD3e molecule, epsilon (CD3-TCR complex) |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCl buffer (pH 8.0), 0.2M NaCl and 10% glycerol. |
| Gene ID | 916 |
Más información
Human CD3E (P07766, 23 a.a. - 126 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.