Ver mas grande
PIP (Human) Recombinant Protein
AB-P9064
Producto nuevo
PIP (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | PIP |
| Gene Alias | GCDFP-15|GCDFP15|GPIP4 |
| Gene Description | prolactin-induced protein |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCl buffer, (pH 8.0), 10% glycerol and 0.4M Urea. |
| Gene ID | 5304 |
Más información
Human PIP (P12273, 29 a.a. - 146 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.