PGF (Human) Recombinant Protein Ver mas grande

PGF (Human) Recombinant Protein

AB-P9036

Producto nuevo

PGF (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name PGF
Gene Alias D12S1900|PGFL|PLGF|PlGF-2|SHGC-10760
Gene Description placental growth factor
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq MLPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 10mM Sodium Phosphate pH 7.5.
Gene ID 5228

Más información

Human PGF (P49763) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

PGF (Human) Recombinant Protein

PGF (Human) Recombinant Protein