Ver mas grande
Human PDGFD (Q9GZP0, 250 a.a. - 370 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in iEscherichi
AB-P9016
Producto nuevo
PDGFD (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | PDGFD |
| Gene Alias | IEGF|MGC26867|MSTP036|SCDGF-B|SCDGFB |
| Gene Description | platelet derived growth factor D |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMSYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCl buffer (pH 8.0), 0.4M Urea and 10% glycerol. |
| Gene ID | 80310 |
Más información
Human PDGFD (Q9GZP0, 250 a.a. - 370 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.