OSM (Human) Recombinant Protein Ver mas grande

Human OSM (P13725) recombinant protein expressed in iEscherichia coli/i.

AB-P8996

Producto nuevo

OSM (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name OSM
Gene Alias MGC20461
Gene Description oncostatin M
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSR.
Form Lyophilized
Antigen species Target species Human
Storage Buffer 1xPBS pH-7.4.
Gene ID 5008

Más información

Human OSM (P13725) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Human OSM (P13725) recombinant protein expressed in iEscherichia coli/i.

Human OSM (P13725) recombinant protein expressed in iEscherichia coli/i.