Ver mas grande
Human TNFRSF11B (O00300, 22 a.a. - 401 a.a.) partial-length recombinant protein with FLAG tag at N-Terminus expressed in HEK293
AB-P8992
Producto nuevo
TNFRSF11B (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | TNFRSF11B |
| Gene Alias | MGC29565|OCIF|OPG|TR1 |
| Gene Description | tumor necrosis factor receptor superfamily, member 11b |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | PGDYKDDDDKPAGETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKD |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from PBS, pH7.5 and 5% (w/v) Trehalose. |
| Gene ID | 4982 |
Más información
Human TNFRSF11B (O00300, 22 a.a. - 401 a.a.) partial-length recombinant protein with FLAG tag at N-Terminus expressed in HEK293 cell.