Ver mas grande
Human IFNA1 partial recombinant protein expressed in iEscherichia coli/i.
AB-P8766
Producto nuevo
IFNA1 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | IFNA1 |
| Gene Alias | IFL|IFN|IFN-ALPHA|IFNA13|IFNA@|MGC138207|MGC138505|MGC138507 |
| Gene Description | interferon, alpha 1 |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNVDSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (1 mg/mL) containing 1X PBS, pH 7.4. |
| Gene ID | 3439 |
Más información
Human IFNA1 partial recombinant protein expressed in Escherichia coli.