Ver mas grande
Mouse Met partial recombinant protein with hIgG His tag in C-terminus expressed in Baculovirus.
AB-P8763
Producto nuevo
Met (Mouse) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | Met |
| Gene Alias | AI838057|HGF|HGFR|Par4|c-Met |
| Gene Description | met proto-oncogene |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | ECKEALVKSEMNVNMKYQLPNFTAETPIQNVVLHGHHIYLGATNYIYVLNDKDLQKVSEFKTGPVLEHPDCLPCRDCSSKANSSGGVWKDNINMALLVDTYYDDQLISCGSVNRGTCQRHVLPPDNSADIQSEVHCMFSPEEESGQCPDCVVSALGAKVLLSEKDRFINFFVGNTINSSYPPGYSLHSISVRRLKETQDGFKFLTDQSYIDVLPEFQDSYPIKYIHAFESNHFIYFLTVQKETLDAQTFHTRIIR |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | Solution (0.25 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol. |
| Gene ID | 17295 |
Más información
Mouse Met partial recombinant protein with hIgG His tag in C-terminus expressed in Baculovirus.