Ver mas grande
Porcine Csf2 recombinant protein expressed in?iEscherichia coli/i.
AB-P8748
Producto nuevo
Csf2 (Porcine) Recombinant Protein
Comprando este producto generará 12 Biopuntos. Su cesta contiene un total 12 Biopuntos puede ser convertido en un Biobonos Descuento 48.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | Csf2 |
| Gene Alias | Gm-csf|Gmcsf |
| Gene Description | colony stimulating factor 2 (granulocyte-macrophage) |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK |
| Form | Lyophilized |
| Antigen species Target species | Pig |
| Storage Buffer | Protein (1 mg/mL) was lyophilized from a solution containing 10 mM sodium phosphate buffer, pH 7.5. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 116630 |
Más información
Porcine Csf2 recombinant protein expressed in?Escherichia coli.