Ver mas grande
Lgals7 (Mouse) Recombinant Protein
AB-P8672
Producto nuevo
Lgals7 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Lgals7 |
| Gene Alias | Galectin-7|MGC151215|MGC151217 |
| Gene Description | lectin, galactose binding, soluble 7 |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMSATQHKTSLPQGVRVGTVMRIRGMVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKEQGKWGREERGTGIPFERGQPFEVLLIATEEGFKAVVGDDEYLHFHHRMPPARVRLVEVGGDVQLHSVKIF |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | Solution (1 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 20% glycerol, 0.1 M NaCl, 2 mM DTT. |
| Gene ID | 16858 |
Más información
Mouse Lgals7 full-length recombinant protein with His tag in N-terminus expressed in Escherichia coli.