Ver mas grande
FST (Human) Recombinant Protein
AB-P8650
Producto nuevo
FST (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | FST |
| Gene Alias | FS |
| Gene Description | follistatin |
| Storage Conditions | Lyophilized protein should be stored at -20ºC. Protein aliquots at 4ºC for 2 weeks. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MKHHHHHHASGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELC |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Protein (0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris, pH 7.5, 20 mM NaCl. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. |
| Gene ID | 10468 |
Más información
Human FST recombinant protein with His tag in N-terminus expressed in Escherichia coli.