Ver mas grande
Porcine FLT3LG recombinant protein expressed in iEscherichia coli/i.
AB-P8648
Producto nuevo
FLT3LG (Porcine) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | FLT3LG |
| Gene Alias | FL |
| Gene Description | fms-related tyrosine kinase 3 ligand |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | MSPDCSFPHSPISSTFANTIRQLSDYLLQDYPVTVASNLQDDELCGAFWRLVLAQRWMGQLKTVAGSQMQKLLEAVNTEIVFVTSCALQPLPSCLRFVQANISHLLQDTSQQLVALKPWITRRNFSRCLELQCQPDPSTLLPPRSPGALEATSLP |
| Form | Lyophilized |
| Antigen species Target species | Pig |
| Storage Buffer | Lyophilized from a solution containing 10 mM Sodium Phosphate, pH 7.5. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 2323 |
Más información
Porcine FLT3LG recombinant protein expressed in Escherichia coli.