Ver mas grande
Monkey FLT3LG recombinant protein expressed in iEscherichia coli/i.
AB-P8647
Producto nuevo
FLT3LG (Monkey) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | LOC719239 |
| Gene Alias | - |
| Gene Description | similar to SL cytokine precursor (Fms-related tyrosine kinase 3 ligand) (Flt3 ligand) (Flt3L) |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVPSNLQDEELCGALWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQHPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPRSPGALEATALTAPQRP |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from a solution containing 1X PBS, pH7.4. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 719239 |
Más información
Monkey FLT3LG recombinant protein expressed in Escherichia coli.