Ver mas grande
Mouse Fgf16 recombinant protein expressed in iEscherichia coli/i.
AB-P8616
Producto nuevo
Fgf16 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | Fgf16 |
| Gene Alias | - |
| Gene Description | fibroblast growth factor 16 |
| Storage Conditions | Stored at 4ºC for 2-4 weeks, should be stored at -20ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFRYR |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | Solution in 20mM Tris-HCl buffer (pH 9.0) cantaining 10% Glycerol, 1M NaCl, 0.02% Tween-20. |
| Gene ID | 80903 |
Más información
Mouse Fgf16 recombinant protein expressed in Escherichia coli.