FGF12 (Human) Recombinant Protein Ver mas grande

FGF12 (Human) Recombinant Protein

AB-P8611

Producto nuevo

FGF12 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

No hay Biopuntos para este producto


Hoja técnica

Size 2 x 10 ug
Gene Name FGF12
Gene Alias FGF12B|FHF1
Gene Description fibroblast growth factor 12
Storage Conditions Stored at 4ºC for 7 days, should be stored at -20ºC.
Immunogen Prot. Seq MSSHHHHHHSSGLVPRGSHMESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGRRKSSGTPTMNGGKVVNQDST
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (1mg/ml) in 20mM Tris buffer (pH 7.5) containing 10% glycerol, 1mM DTT, 2mM EDTA.
Gene ID 2257

Más información

Human FGF12 partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.

Consulta sobre un producto

FGF12 (Human) Recombinant Protein

FGF12 (Human) Recombinant Protein