FGF1 (Human) Recombinant Protein Ver mas grande

Human FGF1 recombinant protein expressed in iEscherichia coli/i.

AB-P8585

Producto nuevo

FGF1 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 ug
Gene Name FGF1
Gene Alias AFGF|ECGF|ECGF-beta|ECGFA|ECGFB|FGF-alpha|FGFA|GLIO703|HBGF1
Gene Description fibroblast growth factor 1 (acidic)
Storage Conditions Stored at 4ºC for 2-4 weeks, should be stored at -20ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing 1X PBS, pH7.4. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 0.1mg-0.25mg/mL. Allow sample to sit for 5 min at 4 &deg
Gene ID 2246

Más información

Human FGF1 recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Human FGF1 recombinant protein expressed in iEscherichia coli/i.

Human FGF1 recombinant protein expressed in iEscherichia coli/i.