Ver mas grande
Human FAS partial recombinant protein with His tag in C-terminus expressed in Baculovirus cell.
AB-P8582
Producto nuevo
FAS (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | FAS |
| Gene Alias | ALPS1A|APO-1|APT1|CD95|FAS1|FASTM|TNFRSF6 |
| Gene Description | Fas (TNF receptor superfamily, member 6) |
| Storage Conditions | Stored at 4ºC for 2-4 weeks, should be stored at -20ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLEHHHHHH |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | In PBS, pH 7.4 (10% glycerol). |
| Gene ID | 355 |
Más información
Human FAS partial recombinant protein with His tag in C-terminus expressed in Baculovirus cell.