Ver mas grande
FAS (Human) Recombinant Protein
AB-P8580
Producto nuevo
FAS (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | FAS |
| Gene Alias | ALPS1A|APO-1|APT1|CD95|FAS1|FASTM|TNFRSF6 |
| Gene Description | Fas (TNF receptor superfamily, member 6) |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) <br>Avoid repea |
| Immunogen Prot. Seq | MRLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRS |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from a solution containing 1X PBS, pH7.4. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 355 |
Más información
Human FAS recombinant protein with His tag in C-terminus expressed in?Escherichia coli.