Ver mas grande
EPGN (Human) Recombinant Protein
AB-P8565
Producto nuevo
EPGN (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | EPGN |
| Gene Alias | ALGV3072|EPG|FLJ75542|PRO9904|epigen |
| Gene Description | epithelial mitogen homolog (mouse) |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | AVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 20mM sodium Phosphate buffer (pH 7.5) and 130mM sodium chloride. |
| Gene ID | 255324 |
Más información
Human EPGN (Q6UW88) recombinant protein expressed in Escherichia coli.