Ver mas grande
Eng (Mouse) Recombinant Protein
AB-P8564
Producto nuevo
Eng (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 5 ug |
| Gene Name | Eng |
| Gene Alias | AI528660|AI662476|CD105|S-endoglin |
| Gene Description | endoglin |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKI |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | Endoglin protein solution (0.5mg/ml) containing Phosphate Buffered Saline (pH 7.4) and 10% glycerol. |
| Gene ID | 13805 |
Más información
Mouse Eng (Q63961, 27a.a. - 581 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in Baculovirus.