Ver mas grande
Human PROK1 (P58294) recombinant protein expressed in iEscherichia coli/i.
AB-P8542
Producto nuevo
PROK1 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | PROK1 |
| Gene Alias | EGVEGF|PK1|PRK1 |
| Gene Description | prokineticin 1 |
| Storage Conditions | Lyophilized EG-VEGF Human Recombinant although stable at room temperature for 3 weeks, should be stored desiccated below -18ºC. Upon reconstitution EG-VEGF should be stored at 4ºC between 2-7 days and for future use below -18ºC. |
| Immunogen Prot. Seq | AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 0.1% Trifluoroacetic Acid (TFA). |
| Gene ID | 84432 |
Más información
Human PROK1 (P58294) recombinant protein expressed in Escherichia coli.