Ver mas grande
Mouse Ctf1 (Q60753) recombinant protein expressed in iEscherichia coli/i.
AB-P8520
Producto nuevo
Ctf1 (Mouse) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | Ctf1 |
| Gene Alias | CT-1 |
| Gene Description | cardiotrophin 1 |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | SQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA. |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.4. |
| Gene ID | 13019 |
Más información
Mouse Ctf1 (Q60753) recombinant protein expressed in Escherichia coli.