Ver mas grande
Mouse Armetl1 (Q8CC36) recombinant protein expressed in iEscherichia coli/i.
AB-P8503
Producto nuevo
Armetl1 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Armetl1 |
| Gene Alias | 9330140G23|CDNF|MGC129430 |
| Gene Description | arginine-rich, mutated in early stage tumors-like 1 |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | QGLEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL. |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | CDNF protein was lyophilized from a 0.2um filtered concentrated solution in 1xPBS, pH 7.4. |
| Gene ID | 227526 |
Más información
Mouse Armetl1 (Q8CC36) recombinant protein expressed in Escherichia coli.