Ver mas grande
Btc (Mouse) Recombinant Protein
AB-P8500
Producto nuevo
Btc (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Btc |
| Gene Alias | - |
| Gene Description | betacellulin, epidermal growth factor family member |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from a 0.2um filtered concentrated solution in 1 PBS, pH 7.4. |
| Gene ID | 12223 |
Más información
Mouse Btc (Q05928) recombinant protein expressed in Escherichia coli.