Ver mas grande
BTC (Human) Recombinant Protein
AB-P8499
Producto nuevo
BTC (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | BTC |
| Gene Alias | - |
| Gene Description | betacellulin |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYHHHHHH. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | BTC protein (0.25mg/mL) contains 10% glycerol and Phosphate-Buffered Saline (pH 7.4). |
| Gene ID | 685 |
Más información
Human BTC (P35070, 32 a.a. - 111 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in HEK293 cells.