Ver mas grande
Ngf (Mouse) Recombinant Protein
AB-P8487
Producto nuevo
Ngf (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Ngf |
| Gene Alias | Ngfb |
| Gene Description | nerve growth factor |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG. |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | The NGF beta Mouse was lyophilized from solution containing 5% mannitol and 1% HSA. |
| Gene ID | 18049 |
Más información
Mouse Ngf (P01139) recombinant protein produced in Submaxillary Gland of Grown Mouse.