TNFSF13B (Human) Recombinant Protein Ver mas grande

Human TNFSF13B (Q9Y275, 134 a.a. - 285 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in iEscheri

AB-P8462

Producto nuevo

TNFSF13B (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name TNFSF13B
Gene Alias BAFF|BLYS|CD257|DTL|TALL-1|TALL1|THANK|TNFSF20|ZTNF4
Gene Description tumor necrosis factor (ligand) superfamily, member 13b
Storage Conditions Store, frozen at -20ºC for longer periods of time.
Immunogen Prot. Seq MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL.
Form Liquid
Antigen species Target species Human
Storage Buffer PBS pH-7.4 and 10% glycerol.
Gene ID 10673

Más información

Human TNFSF13B (Q9Y275, 134 a.a. - 285 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.

Consulta sobre un producto

Human TNFSF13B (Q9Y275, 134 a.a. - 285 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in iEscheri

Human TNFSF13B (Q9Y275, 134 a.a. - 285 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in iEscheri