Ver mas grande
Human BDNF (P23560) recombinant protein expressed in iEscherichia coli/i.
AB-P8457
Producto nuevo
BDNF (Human) Recombinant Protein,homodimer
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | BDNF |
| Gene Alias | MGC34632 |
| Gene Description | brain-derived neurotrophic factor |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized without additives. |
| Gene ID | 627 |
Más información
Human BDNF (P23560) recombinant protein expressed in Escherichia coli.