CLU (Dog) Recombinant Protein Ver mas grande

Dog CLU (P25473) recombinant protein with FLAG-tag at N-terminal expressed in HEK293 cells.

AB-P8437

Producto nuevo

CLU (Dog) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name CLU
Gene Alias GP80
Gene Description clusterin
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq PGDYKDDDDKPAGDQAVSDTELQEMSTEGSKYINKEIKNALKGVKQIKTLIEQTNEERKSLLSNLEEAKKKKEDALNDTKDSETKLKASQGVCNDTMMALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHALDVMQDSFNRASSIMDELFQDRFFTREPQDTYHYSPFSLFQRRPFFNPKFRIARNIIPFPRFQPLNFHDMFQPFFDMIHQAQQAMDVNLHRI
Form Lyophilized
Antigen species Target species Dog
Storage Buffer Lyophilized from 20mM Tris buffer and 20mM NaCl, pH 7.5.
Gene ID 442971

Más información

Dog CLU (P25473) recombinant protein with FLAG-tag at N-terminal expressed in HEK293 cells.

Consulta sobre un producto

Dog CLU (P25473) recombinant protein with FLAG-tag at N-terminal expressed in HEK293 cells.

Dog CLU (P25473) recombinant protein with FLAG-tag at N-terminal expressed in HEK293 cells.