Ver mas grande
Rat Clu (P05371) recombinant protein with T7-tag at N-terminal fusion and His-tag at C-terminal expressed in iEscherichia coli/i
AB-P8435
Producto nuevo
Clu (Rat) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | Clu |
| Gene Alias | APOJ|CLI|RATTRPM2B|SGP-2|SGP2|SP-40|TRPM-2|TRPM2B|Trpm2|Trpmb |
| Gene Description | clusterin |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MASMTGGQQMGRDPNSSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFTRASGIIDTLFQDRFFTHEPQDIHHFSPMGFPHKRPHLLYPKSRLVRSLMPLSHYGPLSFHNMFQPFFDMIHQAQQAMDVQLHSPALQFPDVDFLKEGEDDRTVCKEIRHNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTQQYNELLHSLQSKMLNTSSLLEQALEHHHHHH. |
| Form | Lyophilized |
| Antigen species Target species | Rat |
| Storage Buffer | Lyophilized from 0.02M Tris buffer and 0.05M NaCl, pH 7.5. |
| Gene ID | 24854 |
Más información
Rat Clu (P05371) recombinant protein with T7-tag at N-terminal fusion and His-tag at C-terminal expressed in Escherichia coli.