ANGPTL7 (Human) Recombinant Protein Ver mas grande

Human ANGPTL7 (O43827, 27 a.a. - 346 a.a.) partial-length recombinant protein expressed in HEK293 cells.

AB-P8415

Producto nuevo

ANGPTL7 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name ANGPTL7
Gene Alias AngX|CDT6|RP4-647M16.2|dJ647M16.1
Gene Description angiopoietin-like 7
Storage Conditions Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles.
Immunogen Prot. Seq QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNC
Form Liquid
Antigen species Target species Human
Storage Buffer 10% glycerol and Phosphate-Buffered Saline (pH 7.4).
Gene ID 10218

Más información

Human ANGPTL7 (O43827, 27 a.a. - 346 a.a.) partial-length recombinant protein expressed in HEK293 cells.

Consulta sobre un producto

Human ANGPTL7 (O43827, 27 a.a. - 346 a.a.) partial-length recombinant protein expressed in HEK293 cells.

Human ANGPTL7 (O43827, 27 a.a. - 346 a.a.) partial-length recombinant protein expressed in HEK293 cells.