Ver mas grande
Human AIF1 (P55008) recombinant protein with His-tag at N-terminal expressed in iEscherichia coli/i.
AB-P8399
Producto nuevo
AIF1 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | AIF1 |
| Gene Alias | AIF-1|IBA1|IRT-1 |
| Gene Description | allograft inflammatory factor 1 |
| Storage Conditions | For long term, store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MKHHHHHHASQTRDLQGGKAF¬GLLKAQQEERLDE-INKQFLDDPKYSSDED¬LPSKLEGFKEKYMEF¬DLNGNGDIDIMSLKRMLEK-LGVPKTHLELKKLI¬GEVSSGSGETFSYP¬DFLRMMLGKRSAIL-KMILMYEEKAREKEK¬PTGPPAKKAISELP. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 20mM Tris buffer and 50mM NaCl pH-7.5. |
| Gene ID | 199 |
Más información
Human AIF1 (P55008) recombinant protein with His-tag at N-terminal expressed in Escherichia coli.