Ver mas grande
IL17F (Human) Recombinant Protein
AB-P8367
Producto nuevo
IL17F (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | IL17F |
| Gene Alias | IL-17F|ML-1|ML1 |
| Gene Description | interleukin 17F |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 20mM Tris-HCl buffer pH 8.0 (0.4M Urea, 10% glycerol) |
| Gene ID | 112744 |
Más información
Human IL17F (Q96PD4, 31 a.a. - 163 a.a.) partial recombinant protein with His-tag at N-terminus expressed in Escherichia coli.