Ver mas grande
Mouse Il3 (P01586, 27 a.a. - 166 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
AB-P8260
Producto nuevo
Il3 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 5 ug |
| Gene Name | Il3 |
| Gene Alias | BPA|Csfmu|HCGF|Il-3|MCGF|PSF |
| Gene Description | interleukin 3 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVECLEHHHHHH |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In PBS pH 7.4 (10% glycerol) |
| Gene ID | 16187 |
Más información
Mouse Il3 (P01586, 27 a.a. - 166 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.