Ver mas grande
IL1B (Human) Recombinant Protein
AB-P8218
Producto nuevo
IL1B (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | IL1B |
| Gene Alias | IL-1|IL1-BETA|IL1F2 |
| Gene Description | interleukin 1, beta |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFV_x005F_x000D__x000D__x005F_x000D__x000D_QGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKME_x005F_x000D__x000D__x005F_x000D__x000D_KRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 20mM Tris-HCl buffer pH 8.0 (50% glycerol) |
| Gene ID | 3553 |
Más información
Human IL1B (P01584, 117 a.a. - 269 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.