Ver mas grande
Human INFG recombinant protein expressed in iEscherichia coli/i.
AB-P8139
Producto nuevo
INFG (Human) Recombinant Protein
Comprando este producto generará 12 Biopuntos. Su cesta contiene un total 12 Biopuntos puede ser convertido en un Biobonos Descuento 48.00EUR.
Hoja técnica
| Size | 1 mg |
| Gene Name | IFNG |
| Gene Alias | IFG|IFI |
| Gene Description | interferon, gamma |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at-20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from a solution containing 1X PBS, pH 4.6. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL in phosphate buffer pH > |
| Gene ID | 3458 |
Más información
Human INFG recombinant protein expressed in Escherichia coli.