Ver mas grande
Human FGF2 (P09038) recombinant protein expressed in iEscherichia coli/i.
AB-P8130
Producto nuevo
FGF2 (Human) Recombinant Protein
Comprando este producto generará 11 Biopuntos. Su cesta contiene un total 11 Biopuntos puede ser convertido en un Biobonos Descuento 44.00EUR.
Hoja técnica
| Size | 1 mg |
| Gene Name | FGF2 |
| Gene Alias | BFGF|FGFB|HBGF-2 |
| Gene Description | fibroblast growth factor 2 (basic) |
| Storage Conditions | Lyophilized although stable at room temperature for 3 weeks, should be stored desiccated below -20ºC. Upon reconstitution should be stored at 4ºC between 2-7 days and for future use below -20ºC.<br>Aliquot to avoid repeated freezing and thawing._x005F_x00 |
| Immunogen Prot. Seq | AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 20mM Tris-HCl, pH7.4 and 1M NaCl |
| Gene ID | 2247 |
Más información
Human FGF2 (P09038) recombinant protein expressed in Escherichia coli.