Ver mas grande
Human PIGR (P01833, 19 a.a. - 638 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.
AB-P8088
Producto nuevo
PIGR (Human) Recombinant Protein
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | PIGR |
| Gene Alias | FLJ22667|MGC125361|MGC125362 |
| Gene Description | polymeric immunoglobulin receptor |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | KSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGARGGCITLISSEGYVSSKYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVSQGPGLLNDTKVYTVDLGRTVTINCPFKTENAQKRKSLYKQIGLYPVLVIDSSGYVNPNYTGRIRLDIQGTGQLLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQ |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In Phosphate-Buffer Saline pH 7.4 (10% glycerol) |
| Gene ID | 5284 |
Más información
Human PIGR (P01833, 19 a.a. - 638 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.