CSF1R (Human) Recombinant Protein Ver mas grande

Human CSF1R (P07333, 20 a.a. - 517 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expressio

AB-P8048

Producto nuevo

CSF1R (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 20 ug
Gene Name CSF1R
Gene Alias C-FMS|CD115|CSFR|FIM2|FMS
Gene Description colony stimulating factor 1 receptor
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq IPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAG
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 1436

Más información

Human CSF1R (P07333, 20 a.a. - 517 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expression system.

Consulta sobre un producto

Human CSF1R (P07333, 20 a.a. - 517 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expressio

Human CSF1R (P07333, 20 a.a. - 517 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expressio